PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01909.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 297aa    MW: 32823.9 Da    PI: 10.0639
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01909.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-093075347
                                    SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                                    +WT+ E +++ +a + l  g  +W+++ar ++ gRt  +++++++++
  Zmw_sc01909.1.g00100.1.am.mkhc 30 SWTAKENKQFERALAALDLGrpDWEKVARAIP-GRTVGEIVDHYRSL 75
                                    7**************9877777**********.***********975 PP

2Myb_DNA-binding48.51.9e-15145189347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE+ l++ + kq+G+g+W++I+r++  +Rt+ q+ s+ qky
  Zmw_sc01909.1.g00100.1.am.mkhc 145 PWTEEEHRLFLLGLKQYGKGDWRSISRYFVHTRTPTQVASHAQKY 189
                                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.1042680IPR017884SANT domain
SMARTSM007174.5E-52778IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-52975IPR009057Homeodomain-like
CDDcd001675.66E-93075No hitNo description
PfamPF002494.7E-73075IPR001005SANT/Myb domain
SuperFamilySSF466894.24E-93082IPR009057Homeodomain-like
PROSITE profilePS5129419.39138194IPR017930Myb domain
SuperFamilySSF466891.66E-18139194IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-17141192IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.609.3E-12142188IPR009057Homeodomain-like
SMARTSM007172.7E-13142192IPR001005SANT/Myb domain
CDDcd001671.62E-11145190No hitNo description
PfamPF002496.2E-13145189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MMREAYMEVL PPMDHYASRS NNWFLGPPRS WTAKENKQFE RALAALDLGR PDWEKVARAI  60
PGRTVGEIVD HYRSLEVDVR RIESGAMMPF SGYGGGGGAN AFTLQWDGKG GHGAGDFRHG  120
HRFAGGCGKR HPGLTPEQER KKGVPWTEEE HRLFLLGLKQ YGKGDWRSIS RYFVHTRTPT  180
QVASHAQKYF IRLNSGGKDK RRSSIHDITT VNLNDDQTPS PSQSSLITNQ PKASAPTAAA  240
SQFSLSADTK QHGSVNLPFS SPSRTPRMPA YGMGLQDQGL QCAPLHDQLV ANTSVLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-142698678RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.11e-160PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-75DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA5HJS51e-179A5HJS5_9POAL; MYB_Al protein
STRINGSi002426m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348